PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00041.1.g00460.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 286aa    MW: 31659.6 Da    PI: 4.8346
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00041.1.g00460.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.23.2e-1967120356
                                   --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   k++++ ++q+++Le++F  +++++ e+++++A+ l+L  rqV vWFqNrRa++k
  Zpz_sc00041.1.g00460.1.sm.mk  67 KKRRLAADQVRALERCFDADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWK 120
                                   4557899**********************************************9 PP

2HD-ZIP_I/II124.84e-4066158193
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   ekkrrl+++qv++LE++F++++kL+perK+++ar+L+l+prqvavWFqnrRAR+ktkq+E+d++aL++++dal++e ++L+
  Zpz_sc00041.1.g00460.1.sm.mk  66 EKKRRLAADQVRALERCFDADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWKTKQIERDFNALRARHDALRHECDELR 146
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLreelke 93 
                                   +++++L++e++e
  Zpz_sc00041.1.g00460.1.sm.mk 147 RDKDALAAEIRE 158
                                   *******99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.00162122IPR001356Homeobox domain
SuperFamilySSF466896.84E-1863124IPR009057Homeodomain-like
SMARTSM003892.3E-1865126IPR001356Homeobox domain
PfamPF000461.6E-1667120IPR001356Homeobox domain
CDDcd000866.71E-1667123No hitNo description
Gene3DG3DSA:1.10.10.601.5E-1873121IPR009057Homeodomain-like
PROSITE patternPS00027097120IPR017970Homeobox, conserved site
PfamPF021832.5E-14122163IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MKRPSCRGFS SVASQEAQEQ QEDSSRSMEQ GLDVHAKRDD AVAGAYDEEE EEDEDELVGG  60
RGGLGEKKRR LAADQVRALE RCFDADNKLD PERKARIARD LRLHPRQVAV WFQNRRARWK  120
TKQIERDFNA LRARHDALRH ECDELRRDKD ALAAEIRELR EKVEKQMSVK LESAEDRLLP  180
GSVAAATAVH KDGSTDSDSS AVFNEEASPY SGGAAFDHHP SFTGFTSSFL APSSTLSSSF  240
PFMYSGGPHL DQEADGFLGA VATADSFFAA EEQGTGLGSW YGGEGW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114122RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983072.11e-122PREDICTED: homeobox-leucine zipper protein HOX8-like isoform X1
RefseqXP_012704164.11e-122PREDICTED: homeobox-leucine zipper protein HOX8-like isoform X1
SwissprotQ338Z71e-90HOX8_ORYSJ; Homeobox-leucine zipper protein HOX8
TrEMBLA0A0A9JEK41e-130A0A0A9JEK4_ARUDO; Uncharacterized protein
STRINGSi040014m1e-121(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.11e-35homeobox protein 16